Active Pharmaceutical Intermediate

GLP-1(7-36), IRP peptide Cas No: 119637-73-9, 107444-51-9 Formula: C149H226N40O45 Molecular: 3297 Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR Purity:98% Appearance: white powder Source: synthetic Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide, Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air.

GLP-1(7-37), Insulinotropin Cas No:16941-32-5, 106612-94-6 (net) Formula: C151H228N40O47 Molecular: 3355.66 Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) Purity:98% Appearance: white powder Source: synthetic Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related

Ghrelin(Rat) Cas No: 258338-12-4 Formula: C147H245N45O42 Molecular:3314.79 Sequence:Gly-Ser-Ser(n-octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg Purity:98% Appearance: white powder Source: synthetic Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any questions or need a

Ghrelin(Human) Cas No: 258279-04-8 Formula: C141H235N47O41 Molecular:3244.66 Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPR Also known as: Motilin-related peptide, Human ghrelin, Ghrelin (human), GSSFLSPEHQRVQQRKESKKPPAKLQPR, Gly-Ser-Ser-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg,glycyl-L-seryl-L-seryl-L-phenylalanyl-L-leucyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-arginyl-L-valyl-L-glutaminyl-L-glutaminyl-L

Ganirelix 1.Basic information: Name: Ganirelix Synonym: Antagon;orgalutran;Ganirelixum Cas No: 123246-29-7 Sequence: Ac-DNal-DCpa-DPal-Ser-Tyr-DHar(Et2)-Leu-Har(Et2)-Pro-DAla -NH2 MF: C80H113ClN18O13 Molecular:1570.4 Purity:95% Source: synthetic Appearance: white powder Chemical structure: Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you

Felypressin Also called: Felipresina, Octapressin Cas No: 56-59-7 Formula: C46H65N13O11S2 Molecular:1040 Sequence: CYS-PHE-PHE-GLN-ASN-CYS-PRO-LYS-GLY-NH2(cyclic (1-6)disulfide) Purity:98% Appearance: white powder Source: synthetic Also known as: Felypressine, Felypressinum, FELYPRESSIN, PLV-2, 2-(L-Phenylalanine)-8-L-lysinevasopressin, Felipressina, Octapressin, Phelypressin, Octopressin Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or

Fertirelin Acetate Cas No: 38234-21-8 Formula: C55H76N16O12 Molecular:1153.29 Sequence: Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-NHEt Purity:98% Appearance: white powder Source: synthetic Also known as:, AGN-PC-00M8G3, [Des-Gly10]-LH-RH Ethylamide, VA10903, A824075 Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any questions or need a

Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4 Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any

Eptifibatide Acetate Also called: eptifibatida, Eptifibatid Cas No:148031-34-9 Formula: C37H53N11O11S2 Molecular:892 Sequence:3-MERCAPTOPROPIONYL-HOMOARG-GLY-ASP-TRP-PRO-CYS-NH2 ACETATE SALT (DISULFIDE BOND) Purity:98% Appearance: white powder Source: synthetic Also known as: Intrifiban,INTEGRILIN ACETATE, CHEBI:291902 ACETATE, 3-MERCAPTOPROPIONYL-HOMOARG-GLY-ASP-TRP-PRO-CYS-NH2 ACETATE, 3-MERCAPTOPROPIONYL-HOMOARG-GLY-ASP-TRP-PRO-CYS-NH2 ACETATE SALT (DISULFIDE BOND) 1

Epitalon Basic information: Name:Epithalon TetraPeptide Other Name: Epithalon; Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;AEDG;Ala-Glu-Asp-Gly; Epitalon;Glycine,L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspartylglycine Sequence: alanyl-glutamyl-aspartyl-glycine Molecular Formula: C14H22N4O9 Molecular Weight: 390.34588 Cas No: 307297-39-8 Purity:98% Grade: pharmaceutical intermediate Appearance: white powder Source: synthetic MSDS and COA:

Eledoisin Acetate 1.Basic information: Name:Eledoisin Acetate Cas No:69-25-0 Formula: C54H85N13O15S Molecular:1188.39 Sequence:Pyr-Pro-Ser-Lys-Asp-Ala-Phe-Ile-Gly-Leu-Met-NH2 Purity:98% Appearance: white powder Source: synthetic Also known as: Eledone peptide, Eledoisinum, ELD 950, ELD-950, Eledoisin (INN), Eledoisin [INN] Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx

Endothelin-1 (human, bovine, dog, mouse, porcine, rat) Acetate 1.Basic information: Name: Endothelin-1 (human, bovine, dog, mouse, porcine, rat) Acetate Cas No: 117399-94-7 (net) MF: C109H159N25O32S5 Molecular: 2491.94 Sequence:H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-OH acetate salt (Disulfide bonds between Cys1 and Cys15/Cys3 and Cys11) Purity:95% Source: synthetic Appearance: white powder Chemical structure: 2.Description:

Elcatonin Acetate Also called elcatonina, elcatonine Cas No:57014-02-5 Formula: C150H248N42O49 Molecular:3423.82 Sequence:Ser-Asn-Leu-Ser-Thr-Asu-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2(bridge 1-7) Purity:98% Appearance: white powder Source: synthetic Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or

Diprotin A Cas No: 90614-48-5 Formula: C17H31N3O4 Molecular: 341.44 Sequence: Ile-Pro-Ile Purity:98% Appearance: white powder Source: synthetic Also known as: isoleucylprolylisoleucine, Ile-Pro-Ile, NSC602337, 90614-48-5, l-isoleucyl-l-prolyl-l-isoleucine, HIV inhibitor Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any questions

Dynorphin (1-17), Dynorphin (1-13) 1.Basic information: Name: Dynorphin (1-17), Dynorphin (1-13) Cas No: 80448-90-4; 72957-38-1 (net) Molecular: C99H155N31O23; C75H126N24O15 MF:2147.28;1603.99 Sequence:H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-OH; H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys- Leu-Lys-OH acetate salt Purity: 95% Source: synthetic Appearance: white powder Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium

Depreotide 1.Basic information: Name: Depreotide Cas No: 161982-62-3 Molecular: C65H96N16O12S2 MF:1357.69 Sequence: Cyclo (L- homocysteinyl-N- methyl- L-phenylalanyl- L-tyrosyl- D-tryptophyl- L-lysyl-L- valyl), (1→1')-sulfide with 3-[(mercaptoacetyl)amino]-L-alanyl-L- lysyl- L-cysteinyl- L- lysinamide Purity: 95% Source: synthetic Appearance: white powder Chemical structure: Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized

Degarelix Cas No: 214766-78-6 Formula: C82H103ClN18O16 Molecular:1632.28 Sequence: Ac-D-2-Nal-D-4-Cpa-D-3-Pal-Ser-4-amino-Phe(L-hydroorotyl)-4-ureido-D-Phe-Leu-Lys(isopropyl)-Pro-D-Ala-NH2 acetate salt Purity:98% Appearance: white powder Source: synthetic Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any questions or need a sample

Delta sleep-inducing peptide,DSIP Cas No: 62568-57-4 Formula: C35H48N10O15 Molecular:850 Sequence: Тrр-Аlа-Gly-Gly-Asp-Ala-Ser-Gly-Glu Purity:98% Appearance: white powder Source: synthetic A nonapeptide that is found in neurons, peripheral organs, and plasma. This neuropeptide induces mainly delta sleep in mammals. In addition to sleep, the peptide has been observed to affect electrophysiological activity, neurotransmitter levels in the brain, circadian and locomotor patterns

Deslorelin Acetate Cas No:57773-65-6(net), 82318-06-7(acetate) Formula: C66H87N17O14 Molecular:1342.5 Sequence:Pyr-His-Trp-Ser-Tye-D-Trp-Leu-Arg-Pro-NHET Purity:98% Appearance: white powder Source: synthetic Also known as: 6-Trp-10-N-Et-GlyNH2-LHRH, Ovuplant, Somagard Please feel free to inquiry :-) Packaging: plastic/glass bottle, aluminium foil bag or customized according to requests, well protected. Shipping: FedEx/DHL/EMS or by air. ntact Us: If you have any questions or

Dirucotide (also known as MBP8298) Cas No:152074-97-0 Formula: C92H141N25O26 Molecular:2013 Sequence: Asp-Glu-Asn-Pro-Val-Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr-OH Purity:98% Appearance: white powder Source: synthetic Dirucotide (also known as MBP8298) was developed by two research scientists (Dr. Kenneth G. Warren, MD, FRCP(C) & Ingrid Catz, Senior Scientist) at the University of Alberta for the treatment of Multiple Sclerosis (MS). Dirucotide is a synthetic peptide